Biology Questions
The best high school and college tutors are just a click away, 24×7! Pick a subject, ask a question, and get a detailed, handwritten solution personalized for you in minutes. We cover Math, Physics, Chemistry & Biology.
Biology
Biomoleculesf the paper chromatography can be seen in Calculations Use the ruler located at the right side of the paper chromatography to calculate the R value for each amino aid in each sample Show your work below Solvent front Start line 2 What is the purpose of spraying the paper with a 0 5 solution of ninhydrin 3 Based on your calculations what amino acids are in samples 1 3 Bacterial Species E coli S aureus Sagalactiae Sample 11 Sample 2 Analysis 1 Referring to the procedure what is the purpose of exposing the dipeptide samples to a 6N HCI solution Sample 3 Medium Composition 70 arginine 20 glutamine 10 threonine 50 valine 10 alanine 40 scrine 60 glutamic acid 10 valine 30 leucine Figure 2 Developed paper chromatography 4 Once you have determined the amino acid composition of each sample you are told that each sample was taken from a specific species of bacteria The dipeptide samples represent the amino acids that are most important to the bacteria s survival and reproduction You are not told which sample represents which bacteria but you are given the amino acid composition of the medium that each bacteria grows best in Medium is a solution of nutrients that allow bacteria to survive and reproduce in a lab Use the table below to determine the species of bacteria that each sample represents
Biology
The Living Worldsign shown indicates B O The vehicle is being drawn by an animal The vehicle is traveling 25 mph or less
Biology
The Living World8 In inclement weather you should Speed up to get off the road quickly Increase your following distance
Biology
Ecology - Ecosystems16 What is the natural rate of unemployment if the frictional structural and cyclical unemployment are 1 5 2 and 4 respectively
Biology
Structural Organization in Animals17 What can you conclude about the current state of US economy if the actual unemployment rate is 3 when the natural rate of unemployment is 5
Biology
Biomolecules18 How in general do unemployment rates vary by age race ethnicity gender occupation and education
Biology
Biotechnology & its Applications13 Why does the official unemployment rate understate the unemployment problem and what is an alternative measure for that
Biology
Cell Cycle and Cell Divisiondeciding whether to pass the truck It is important to Flock your handlichte
Biology
Biotechnology & its ApplicationsUSA FAST 1 es not increase the chance of a crash Increases your ability to react to a hazard
Biology
Human Physiology - GeneralA cell with 20 solutes salt sugar proteins and 80 water is surrounded by an environment of 40 solutes What will most likely happen to the cell due to osmotic pressure O It will shrink O It will swell It will remain the same size It will dissolve
Biology
Human Health and DiseasesYou should always yield to oncoming traffic and pedestrians Oncoming traffic and pedestrians should yield to you
Biology
Biotechnology & its Applications4 What determine the long run trend of real GDP What about the business cycle
Biology
Human Health and Diseases2 Some people harbor Clostridioides difficile as a natural inhabitant of their gastrointestinal tract However this bacterium is unlikely to cause diarrhea unless the person recently underwent an antibiotic regimen especially a broad spectrum antibiotic treatment Why would taking a broad spectrum antibiotic treatment put a patient at risk for C difficile diarrhea
Biology
Cell: The Unit of LifeCritical Thinking 1 Design an endospore staining procedure where carbolfuchsin and methylene blue are used as the dyes Describe your protocol based on the fundamentals of the Schaeffer Fulton endospore staining method
Biology
Biotechnology & its Applicationsof ADH from C intestini and calculate various properties The website for Expasy Protparam is https web expasy org protparam Click on the link and paste the sequence of the ADH into the box Click Compute parameters ADHCommensalibacter intestini MSTTFFIPSINVVGENALNDAVPHILGHGFKHGLIVTDEFMNKSGVAQKVSDLLAKSGINTSIF DGTHPNPTVSNVNDGLKILKANNCDFVISLGGGSPHDCAKGIALLASNGGEIKDYEGLDVPKKP QLPLVSINTTAGTASEITRFCIITDEVRHIKMAIVTSMVTPILSVNDPALMAAMPPGLTAATGM DALTHAIEAYVSTAASPITDACALKAATMISENLRTAVKDGKNMAARESMAYAQLLAGMAFNNA SLGYVHAMAHQLGGFYGLPHGVCNAVLLPHVQEYNLPTCAGRLKDMAKAMGVNVDKMSDEEGGK ACIAAIRALSKDVNI 1 What is the molecular weight of the ADH Be sure to include units in your answer PANLTELKVKAEDIPTLAANALKDACGVTNPROGPOSEVEAIFKSAM 2 4pts What Absorbance value do proteins absorb light based on their amino acid sequence 3 Which amino acids absorb light at this value 4 What is the extinction coefficient of the ADH determined by Expasy Protparam accumin
Biology
Microbes in Human WelfareCritical Thinking 1 Some oral bacteria produce an extracellular capsule Why may a capsule benefit these cells
Biology
Biotechnology: Principles and Processesund 2 If having a capsule is an important advantage for certain pathogens then why wouldn t evolution favor all pathogens being encapsulated
Biology
The Living Worldor 1 Who is required by law to wear a seat belt of be restrained in a child safety seat The driver and all passengers younger than 12 years of age The driver and all passengers younger than 18 years of age
Biology
Cell Cycle and Cell DivisionHe likely doesn t have any copper He made extra copper in the experiment His product is some copper but it is contaminated with other reagents or still wet with water Question 3 Kemmi Major is working through the lab and has a black powder substance What is happening in the reaction Kimmi has copper II oxide as a product This is normal for the step she is on Kimmi has copper II hydroxide as a product This is normal for the step she is on
Biology
Cell Cycle and Cell DivisionDoc Inmaking weighed 0 5312g of copper and explored the reactions in the copper recovery lab His final weight of copper on a piece of filter paper was 1 3421g the dry filter paper weighed 0 8902g What was the percent recovery of Doc s copper sample Answer to 3 significant figures units of
Biology
The Living WorldAccording to the lesson which of the following is MOST likely to influence China s trade practices O World Health Organization O World Tourism Organization O World Trade Organization World Economic Forum
Biology
Cell: The Unit of LifeWhat is the relationship between standardization and the growth of the telecommunications industry The growth of the telecommunications was based on the invention of the fiber optic cable which allowed for the industry trans ocean communication Standardization had no part in the growth of the telecommunications industry Standardization refers to the growth of assembly line rather production than O craftsmanship in the Industrial Revolution It has no bearing on telecommunications
Biology
Ecology - GeneralWhat is the fundamental rationale for distance learning To increase educational opportunities for all students To increase access to more and higher level courses To develop academic O competence in areas where teachers may be in short supply
Biology
Cell: The Unit of LifeE commerce O resulted from the use of the World Wide Web and Internet the use of personal computers in most households the use of laptop computers in colleges and universities the use of the World Wide Web as a tool for consumerism
Biology
Ecology - GeneralWhich is a true statement The United States is an example O of a service economy functioning in market capitalism The United States is an example O of a mixed economy functioning in pure capitalism The United States is an example of a manufacturing economy functioning in market capitalism The United States is an example O of a service economy functioning
Biology
Anatomy of Flowering PlantsAn economic system driven by Internet commerce An economic theory stating that supply equals demand An economic theory that states that countries with comparative O advantage in production for one good should specialize in that good only An economic system derived from socialism
Biology
Anatomy of Flowering PlantsWhich of the following completes the chart following BEST The product Prior knowledge Non tangible Knowledge ideas Prior O The product Imagination
Biology
BiomoleculesEN 000 OOO OOO Q III IV A normal economy will never be in by innovation Innovation increases the economy Innovation stimulates investment lys be disrupte All of the economic ideas in the list belong to which of the following economists John Maynard Keynes O Adam Smith O Friedrich Hayek
Biology
Anatomy of Flowering PlantsPrice comparisons can be handled instantly Advertising on the INTERNET Which of the following best completes the diagram Radio advertising has become more important Geographic territories are no longer relevant Prices on goods purchased on the Internet have increased
Biology
Animal KingdomOOO Why do you think that writers of 10 Things I Hate About You chose to set their adaptation in a modern high school They wanted to make the story O appealing to a new generation of viewers They wanted to stick to Shakespeare s script as closely as possible They wanted to make the story O appealing to an older generation of viewers They wanted to make the story O appealing to students and
Biology
Cell: The Unit of Lifehat sensory structures do the flatworms use to detect the presence of the egg yolk Now obtain a new dish with a few more flatworms Place a small piece of raw liver or beef in this dish and observe the response Is it similar to the response seen with the egg yolk Does the response occur more quickly with one food source than the other
Biology
Cell Cycle and Cell DivisionChoose the correct answer Sarcasm which uses polite words a bitter tone is called but misplaced sarcasm O flagrant sarcasm O raging sarcasm
Biology
BiomoleculesSelect all that apply Which are similarities between RNA and DNA Both are built using a monomer that contains a hexose sugar Both are built from monomers con taining a pentose sugar a phos phate and a base Both are made of subunits linked by phosphodiester bonds Both include the bases A T C G and U Both include the bases A T C and G Both contain ribose sugar Both are responsible for the trans mission of genetic information be tween generations Both are made of nucleotides Both contain deoxyribose sugar
Biology
Biotechnology & its ApplicationsWhich variables are counter cyclical among profit inflation unemploy wages private debt public debt government budget tax revenues go spending financial market and import
Biology
Ecology - General11 Explain why labor force participation rate declines during a recession 12 What are the examples for the group not in labor force
Biology
Cell: The Unit of Lifee Page 76 4 8 Identify the main differences between a plant cell and an animal cell You are looking into the microscope at a cell that you placed into salty water You were expecting the cell to shrivel up but it seems to have mostly held its shape Is this cell a plant or an animal cell animal cell Click or tap a choice to answer the question plant cell
Biology
Cell: The Unit of Lifethe main differences between a plant cell and an animal cell Your lab partner forgot to label the cell culture and the microscope is broken You aren t sure if you have plant cells or animal cells Luckily you have access to a variety of agents you can use to disable various organelles Determine which agents you could use to figure out if you have plant cells or animal cells Can Be Used to Differentiate Between Plant and Animal Cells Cellulolytic enzyme degrades the cell wall Distilled water causes swelling of the central vacuole Staphylococcus alpha toxin disables the function of mitochondria Lithium hydroxide causes the breakdown of phospholipid membranes Ricin disables the function of ribosomes Zn2 disables the function of chloroplasts T
Biology
Human Health and DiseasesNormal text Y Arial Reasoning 11 Reasoning B IU 3 Claim A fecal transplant can work to cure a patient infected with harmful bacteria such as C difficile in many different ways Evidence from the data 5 Evidence from the data Food and space form the immune selles are good for your body 3 Subclaim 1 Bacteria from the fecal transplant can fill up the space in the gut which limits the food and space for invading harmful bacteria Subclaim 2 Bacteria from the fecal transplan can help the patients body produce immune cells