Biotechnology & its Applications Questions and Answers

Question 4 1 point Listen Which of the following is a property of living things that involves the transfer of energy from one form to another Reproduction Homeostasis Metabolism Page 4 Growth
Biology
Biotechnology & its Applications
Question 4 1 point Listen Which of the following is a property of living things that involves the transfer of energy from one form to another Reproduction Homeostasis Metabolism Page 4 Growth
Looking at the diagram which vehicles are required to stop for the school bus red on a multiple lane road divided by a physical barrier A and B A B and D
Biology
Biotechnology & its Applications
Looking at the diagram which vehicles are required to stop for the school bus red on a multiple lane road divided by a physical barrier A and B A B and D
ten All plants that contain GMO genes are a product of genetic engineering True False
Biology
Biotechnology & its Applications
ten All plants that contain GMO genes are a product of genetic engineering True False
Match the following cycle step with its appropriate temperature 00 72 C 55 C 94 C 1 Denaturation 2 Annealing 3 Elongation
Biology
Biotechnology & its Applications
Match the following cycle step with its appropriate temperature 00 72 C 55 C 94 C 1 Denaturation 2 Annealing 3 Elongation
In gel electrophoresis we use Gelstar reagent to O a To denature DNA b Make the DNA dense so they will sink to the bottom of the well c Track the DNA while DNA runs d Stain the DNA in order to visualize them under UV light
Biology
Biotechnology & its Applications
In gel electrophoresis we use Gelstar reagent to O a To denature DNA b Make the DNA dense so they will sink to the bottom of the well c Track the DNA while DNA runs d Stain the DNA in order to visualize them under UV light
Which of the following is true regarding the steps of PCR a All are correct b Denaturation occurs at 95C Annealing is the step where the two primers bind with the target gene sequence complementa d Taq polymerase is needed in adding the DNTPs in making the new DNA strand
Biology
Biotechnology & its Applications
Which of the following is true regarding the steps of PCR a All are correct b Denaturation occurs at 95C Annealing is the step where the two primers bind with the target gene sequence complementa d Taq polymerase is needed in adding the DNTPs in making the new DNA strand
elongating the DNA template by the polymerase True False Question 8 1 point 4 Listen Taq polymerase is extracted from a Thermus aquaticus b Bacillus cereus red because they help in denaturing the DNA and therefore in c Escherichia coli who lives in hot springs
Biology
Biotechnology & its Applications
elongating the DNA template by the polymerase True False Question 8 1 point 4 Listen Taq polymerase is extracted from a Thermus aquaticus b Bacillus cereus red because they help in denaturing the DNA and therefore in c Escherichia coli who lives in hot springs
Part A Identify the structure shown within the highlighted circle X 425 f 23
Biology
Biotechnology & its Applications
Part A Identify the structure shown within the highlighted circle X 425 f 23
7 Part A What is the name of the division of cytosol and organelles as shown in image C DESE SE O A 3 1 D B4
Biology
Biotechnology & its Applications
7 Part A What is the name of the division of cytosol and organelles as shown in image C DESE SE O A 3 1 D B4
If the roadway is wet or icy you should Follow the posted speed limit Reduce your speed
Biology
Biotechnology & its Applications
If the roadway is wet or icy you should Follow the posted speed limit Reduce your speed
When passing another vehicle Pass the vehicle as slowly as possible Drive at the same speed as the vehicle you are passing
Biology
Biotechnology & its Applications
When passing another vehicle Pass the vehicle as slowly as possible Drive at the same speed as the vehicle you are passing
A You are car A and the traffic in front of you is stopped You should Move up and stop between the railroad crossing gates in case they close Move up directly behind the red car B and wait for traffic to proceed
Biology
Biotechnology & its Applications
A You are car A and the traffic in front of you is stopped You should Move up and stop between the railroad crossing gates in case they close Move up directly behind the red car B and wait for traffic to proceed
7 Use the molecular weight of sucrose to calculate the molarity M of 240 mL of a regular soda solution Then use the molecular weight of aspartame to calculate molarity M of a 240 mL of a diet soda solution Show all of your work and account for units of measure Molarity of Diet Soda M Molarity of Regular Soda M 8 Consider the regular soda solution above as a stock solution that you will use to make 240 mL of a working solution with the molarity calculated above for the diet soda How much stock solution do you need a 2
Biology
Biotechnology & its Applications
7 Use the molecular weight of sucrose to calculate the molarity M of 240 mL of a regular soda solution Then use the molecular weight of aspartame to calculate molarity M of a 240 mL of a diet soda solution Show all of your work and account for units of measure Molarity of Diet Soda M Molarity of Regular Soda M 8 Consider the regular soda solution above as a stock solution that you will use to make 240 mL of a working solution with the molarity calculated above for the diet soda How much stock solution do you need a 2
When turning left at an intersection O You should always yield to oncoming traffic and pedestrians Oncoming traffic and pedestrians should yield to you You should never yield to oncoming traffic and pedestrians
Biology
Biotechnology & its Applications
When turning left at an intersection O You should always yield to oncoming traffic and pedestrians Oncoming traffic and pedestrians should yield to you You should never yield to oncoming traffic and pedestrians
a b 10X C 40X d 100X 9 A specimen that was viewed at 10X Ocular Lens and 40X Objective has a Total Magnification of a 40x b 100X C 400X d 4000X 10 Label the following as an Animal Plant and or Bacteria Cell
Biology
Biotechnology & its Applications
a b 10X C 40X d 100X 9 A specimen that was viewed at 10X Ocular Lens and 40X Objective has a Total Magnification of a 40x b 100X C 400X d 4000X 10 Label the following as an Animal Plant and or Bacteria Cell
osteons canals trabeculae perforating fibers Question 20 1 point Listen Intramembranous ossification is one way to make bone In intramembranous ossification what is the model for the bone s shape another bone a connective tissue sheet a sheet of simple squamous epithelium
Biology
Biotechnology & its Applications
osteons canals trabeculae perforating fibers Question 20 1 point Listen Intramembranous ossification is one way to make bone In intramembranous ossification what is the model for the bone s shape another bone a connective tissue sheet a sheet of simple squamous epithelium
Question 5 Points 2 Which among the following has a positive connotation Eccentric O Bizarre O Unique O Weird
Biology
Biotechnology & its Applications
Question 5 Points 2 Which among the following has a positive connotation Eccentric O Bizarre O Unique O Weird
2 Explain the steps of PCR 3 What is 4 5 6 1 7 8 10 The What Symbol what GMO stand for are for Elongation What is example of GMO the steps for gel Electrophoresis procedure Explain The Polymerase Chain reaction Where The amplity tablin fount How many type of What is the fragment of DNA GMO we can find in plan food a
Biology
Biotechnology & its Applications
2 Explain the steps of PCR 3 What is 4 5 6 1 7 8 10 The What Symbol what GMO stand for are for Elongation What is example of GMO the steps for gel Electrophoresis procedure Explain The Polymerase Chain reaction Where The amplity tablin fount How many type of What is the fragment of DNA GMO we can find in plan food a
O Think about all the choices you can make on a school day Brainstorm some of the choices you make and the consequences you face as a result together as a class Using the brainstorm think about a specific time you had to make a choic at school and create a plan for writing your narrative Write a short narrative with an incident response and reflection Type your rough draft on a Google doc and submit this on Canvas by 9 13 at 11 59 pm
Biology
Biotechnology & its Applications
O Think about all the choices you can make on a school day Brainstorm some of the choices you make and the consequences you face as a result together as a class Using the brainstorm think about a specific time you had to make a choic at school and create a plan for writing your narrative Write a short narrative with an incident response and reflection Type your rough draft on a Google doc and submit this on Canvas by 9 13 at 11 59 pm
13 Why does the official unemployment rate understate the unemployment problem and what is an alternative measure for that
Biology
Biotechnology & its Applications
13 Why does the official unemployment rate understate the unemployment problem and what is an alternative measure for that
USA FAST 1 es not increase the chance of a crash Increases your ability to react to a hazard
Biology
Biotechnology & its Applications
USA FAST 1 es not increase the chance of a crash Increases your ability to react to a hazard
4 What determine the long run trend of real GDP What about the business cycle
Biology
Biotechnology & its Applications
4 What determine the long run trend of real GDP What about the business cycle
of ADH from C intestini and calculate various properties The website for Expasy Protparam is https web expasy org protparam Click on the link and paste the sequence of the ADH into the box Click Compute parameters ADHCommensalibacter intestini MSTTFFIPSINVVGENALNDAVPHILGHGFKHGLIVTDEFMNKSGVAQKVSDLLAKSGINTSIF DGTHPNPTVSNVNDGLKILKANNCDFVISLGGGSPHDCAKGIALLASNGGEIKDYEGLDVPKKP QLPLVSINTTAGTASEITRFCIITDEVRHIKMAIVTSMVTPILSVNDPALMAAMPPGLTAATGM DALTHAIEAYVSTAASPITDACALKAATMISENLRTAVKDGKNMAARESMAYAQLLAGMAFNNA SLGYVHAMAHQLGGFYGLPHGVCNAVLLPHVQEYNLPTCAGRLKDMAKAMGVNVDKMSDEEGGK ACIAAIRALSKDVNI 1 What is the molecular weight of the ADH Be sure to include units in your answer PANLTELKVKAEDIPTLAANALKDACGVTNPROGPOSEVEAIFKSAM 2 4pts What Absorbance value do proteins absorb light based on their amino acid sequence 3 Which amino acids absorb light at this value 4 What is the extinction coefficient of the ADH determined by Expasy Protparam accumin
Biology
Biotechnology & its Applications
of ADH from C intestini and calculate various properties The website for Expasy Protparam is https web expasy org protparam Click on the link and paste the sequence of the ADH into the box Click Compute parameters ADHCommensalibacter intestini MSTTFFIPSINVVGENALNDAVPHILGHGFKHGLIVTDEFMNKSGVAQKVSDLLAKSGINTSIF DGTHPNPTVSNVNDGLKILKANNCDFVISLGGGSPHDCAKGIALLASNGGEIKDYEGLDVPKKP QLPLVSINTTAGTASEITRFCIITDEVRHIKMAIVTSMVTPILSVNDPALMAAMPPGLTAATGM DALTHAIEAYVSTAASPITDACALKAATMISENLRTAVKDGKNMAARESMAYAQLLAGMAFNNA SLGYVHAMAHQLGGFYGLPHGVCNAVLLPHVQEYNLPTCAGRLKDMAKAMGVNVDKMSDEEGGK ACIAAIRALSKDVNI 1 What is the molecular weight of the ADH Be sure to include units in your answer PANLTELKVKAEDIPTLAANALKDACGVTNPROGPOSEVEAIFKSAM 2 4pts What Absorbance value do proteins absorb light based on their amino acid sequence 3 Which amino acids absorb light at this value 4 What is the extinction coefficient of the ADH determined by Expasy Protparam accumin
Which variables are counter cyclical among profit inflation unemploy wages private debt public debt government budget tax revenues go spending financial market and import
Biology
Biotechnology & its Applications
Which variables are counter cyclical among profit inflation unemploy wages private debt public debt government budget tax revenues go spending financial market and import
Critical Thinking 1 Compare the sizes of Bacillus cereus Micrococcus luteus and Rhodospirillum rubrum cells or their substitutes as measured using a basic stain Ex 11 and an acidic stain What might account for any difference s
Biology
Biotechnology & its Applications
Critical Thinking 1 Compare the sizes of Bacillus cereus Micrococcus luteus and Rhodospirillum rubrum cells or their substitutes as measured using a basic stain Ex 11 and an acidic stain What might account for any difference s
Which is the best description of the tertiary level of protein structure O A chain of amino acids with folds and pleats which is additionally folded and held to gether by bonds and interactions between R groups of amino acids O Two or more proteins associated into a complex O A chain of amino acids with no folding O A chain of amino acids folded into pleats and helices held together by hydrogen bonds
Biology
Biotechnology & its Applications
Which is the best description of the tertiary level of protein structure O A chain of amino acids with folds and pleats which is additionally folded and held to gether by bonds and interactions between R groups of amino acids O Two or more proteins associated into a complex O A chain of amino acids with no folding O A chain of amino acids folded into pleats and helices held together by hydrogen bonds
You work at a biotech company on an enzyme that produces an anti cancer compound from a substrate To maximize production how would you want to manipulate Vmax Km and Kcat
Biology
Biotechnology & its Applications
You work at a biotech company on an enzyme that produces an anti cancer compound from a substrate To maximize production how would you want to manipulate Vmax Km and Kcat
Radioactive isotopes only have harmful efects O True False
Biology
Biotechnology & its Applications
Radioactive isotopes only have harmful efects O True False
4 a Feed conversion ratio FCR is the mass of animal feed in kilograms required for farmed animals to produce one kilogram of edible mass For example the FCR for salmon is 1 2 and for chicken is 2 2 Deduce the implication of these ratios for sustainability 2 b Models are used as representations of the real world Evaluate the use of food webs to represent ecological communities 2 5 Explain the technique used to estimate the population size of a named species of organism
Biology
Biotechnology & its Applications
4 a Feed conversion ratio FCR is the mass of animal feed in kilograms required for farmed animals to produce one kilogram of edible mass For example the FCR for salmon is 1 2 and for chicken is 2 2 Deduce the implication of these ratios for sustainability 2 b Models are used as representations of the real world Evaluate the use of food webs to represent ecological communities 2 5 Explain the technique used to estimate the population size of a named species of organism
Armed with knowledge of what makes bacterial cells unique think about how you would design an effective antibiotic Answer the following two questions within a few sentences What part of the bacteria you would want to target and why AKA What would be an effective way to kill the bacteria 4 points How it will be selective for bacteria over human cells 4 points
Biology
Biotechnology & its Applications
Armed with knowledge of what makes bacterial cells unique think about how you would design an effective antibiotic Answer the following two questions within a few sentences What part of the bacteria you would want to target and why AKA What would be an effective way to kill the bacteria 4 points How it will be selective for bacteria over human cells 4 points
two races stamps the colored race with a badge of inferiority If this be so it is not by reason of anything found in the act but solely because the colored race chooses to put that construction upon it Based on this quote and your own knowledge this portion of a Supreme Court opinion is the basis for the set up in Plessy v Ferguson O integration O assimilation separate but equal doctrine quality doctring
Biology
Biotechnology & its Applications
two races stamps the colored race with a badge of inferiority If this be so it is not by reason of anything found in the act but solely because the colored race chooses to put that construction upon it Based on this quote and your own knowledge this portion of a Supreme Court opinion is the basis for the set up in Plessy v Ferguson O integration O assimilation separate but equal doctrine quality doctring
Study this series Greek Latin German French Based on the series of languages and your own knowledge which of these finishes the series O Italian Spanish O Greek
Biology
Biotechnology & its Applications
Study this series Greek Latin German French Based on the series of languages and your own knowledge which of these finishes the series O Italian Spanish O Greek
Teachers Industrial engineers Agricultural scientists Based on this list and your own knowledge this list of occupations was critical in the building of America and all were products of O Classical education Olvy league education O Land grant universities Private philanthropic
Biology
Biotechnology & its Applications
Teachers Industrial engineers Agricultural scientists Based on this list and your own knowledge this list of occupations was critical in the building of America and all were products of O Classical education Olvy league education O Land grant universities Private philanthropic
Which of the following is NOT a disadvantage of sole proprietorships The sole proprietor cannot share losses Credit can be obtained but it is limited The business dies with the sole proprietor Shareholders can sell their shares at any time
Biology
Biotechnology & its Applications
Which of the following is NOT a disadvantage of sole proprietorships The sole proprietor cannot share losses Credit can be obtained but it is limited The business dies with the sole proprietor Shareholders can sell their shares at any time
If you wanted to begin a long term business in which you are responsible for all debts and decision making but you need partners to invest money in your company to make a profit the best type of business to start would be a O joint venture O partnership limited partnership franchise
Biology
Biotechnology & its Applications
If you wanted to begin a long term business in which you are responsible for all debts and decision making but you need partners to invest money in your company to make a profit the best type of business to start would be a O joint venture O partnership limited partnership franchise
What is a positive feature of first person narration O It is a natural story technique The narrator cannot be O identified A first person narrator brings O immediacy and a sense of life to the story The first person pronoun I is
Biology
Biotechnology & its Applications
What is a positive feature of first person narration O It is a natural story technique The narrator cannot be O identified A first person narrator brings O immediacy and a sense of life to the story The first person pronoun I is
II Isolation of natural products caffeine from Structure H Procedure H C N N CH N N CH3 Figure 3 Caffeine Introduction and Purpose Caffeine is a stimulant and psychoactive chemical which is found in a wide variety of plants worldwide including coffee beans and tea leaves The purpose of this lab is to isolate caffeine from black tea leaves by solid liquid extraction followed by a liquid liquid extraction to recover the caffeine from the aqueous extract The caffeine will be purified by sublimation Solid Liquid Extraction of Caffeine from Tea Leaves with Water Empty and pour 8 teabags of black tea powder into a 500 mL Erlenmeyer flask record the weight of the tea powder Add 150 mL of water 7 g of calcium carbonate to help eliminate tannic acids present and a stirring bar Bring the contents to a boil then simmer for 30 45 minutes on a hot plate with stirring Use small amounts of water from a squirt bottle to keep the tea powder off the walls of the flask Set up a 500 mL clean filter flask and a Buchner funnel with filter paper Seat the filter paper with water then place a thin layer of celite 10 gram across top of the filter paper Lightly wet the celite to form a cake of celite on the filter paper Filter the hot tea solution through the pre prepared vacuum Rinse the collected solid lightly with hot water then quickly press the tea leaves in the funnel with a stopper to help squeeze out excess liquid Discard the collected solid in the solid waste container Liquid Liquid Extraction of Caffeine from Tea Solution with Methylene Chloride Transfer the cool tea solution to a 250 mL separatory funnel Add 30 mL of dichloromethane then stopper the funnel and gently swirl the contents Occasionally vent any pressure that may have built up inside the funnel and place the funnel into a ring stand Allow the contents in the separatory funnel to settle There should be two separate layers If there is an emulsion cloudy layer between two clear layers it is sometimes possible to break the emulsion by stirring the contents using a glass rod or adding sodium chloride solution If the emulsion persists seek your TA or instructor to help Carefully drain the lower
Biology
Biotechnology & its Applications
II Isolation of natural products caffeine from Structure H Procedure H C N N CH N N CH3 Figure 3 Caffeine Introduction and Purpose Caffeine is a stimulant and psychoactive chemical which is found in a wide variety of plants worldwide including coffee beans and tea leaves The purpose of this lab is to isolate caffeine from black tea leaves by solid liquid extraction followed by a liquid liquid extraction to recover the caffeine from the aqueous extract The caffeine will be purified by sublimation Solid Liquid Extraction of Caffeine from Tea Leaves with Water Empty and pour 8 teabags of black tea powder into a 500 mL Erlenmeyer flask record the weight of the tea powder Add 150 mL of water 7 g of calcium carbonate to help eliminate tannic acids present and a stirring bar Bring the contents to a boil then simmer for 30 45 minutes on a hot plate with stirring Use small amounts of water from a squirt bottle to keep the tea powder off the walls of the flask Set up a 500 mL clean filter flask and a Buchner funnel with filter paper Seat the filter paper with water then place a thin layer of celite 10 gram across top of the filter paper Lightly wet the celite to form a cake of celite on the filter paper Filter the hot tea solution through the pre prepared vacuum Rinse the collected solid lightly with hot water then quickly press the tea leaves in the funnel with a stopper to help squeeze out excess liquid Discard the collected solid in the solid waste container Liquid Liquid Extraction of Caffeine from Tea Solution with Methylene Chloride Transfer the cool tea solution to a 250 mL separatory funnel Add 30 mL of dichloromethane then stopper the funnel and gently swirl the contents Occasionally vent any pressure that may have built up inside the funnel and place the funnel into a ring stand Allow the contents in the separatory funnel to settle There should be two separate layers If there is an emulsion cloudy layer between two clear layers it is sometimes possible to break the emulsion by stirring the contents using a glass rod or adding sodium chloride solution If the emulsion persists seek your TA or instructor to help Carefully drain the lower
This part of the microscope is used as a handle to carry the microscope objectives nosepiece arm mechanical stage O condenser or illuminator
Biology
Biotechnology & its Applications
This part of the microscope is used as a handle to carry the microscope objectives nosepiece arm mechanical stage O condenser or illuminator
Dr Henry s graduate student is also interested in the development of spatial reasoning in early childhood but she thinks that she can find improvements in that type of cognitive task over a smaller amount of time if she teaches the children how the moving ball works So she takes a group of 2 year olds and tests them each week on the spatial reasoning task for 3 months to see if the training will help them letter to reason about spatial relations more quickly What developmental research design is this longitudinal microdevelopment cross sectional sequential
Biology
Biotechnology & its Applications
Dr Henry s graduate student is also interested in the development of spatial reasoning in early childhood but she thinks that she can find improvements in that type of cognitive task over a smaller amount of time if she teaches the children how the moving ball works So she takes a group of 2 year olds and tests them each week on the spatial reasoning task for 3 months to see if the training will help them letter to reason about spatial relations more quickly What developmental research design is this longitudinal microdevelopment cross sectional sequential
The Mayor felt the crunch of bones in his jaw and his eyes filled with tears But he didn t breathe until he felt the tooth come out Then he saw it through his tears It seemed so foreign to his pain that he failed to understand his torture of the five previous nights O It is not important It provides context and explains Owhy the dentist dislikes the mayor It provides context and explains Owhy the mayor dislikes the dentist O It is a flashback
Biology
Biotechnology & its Applications
The Mayor felt the crunch of bones in his jaw and his eyes filled with tears But he didn t breathe until he felt the tooth come out Then he saw it through his tears It seemed so foreign to his pain that he failed to understand his torture of the five previous nights O It is not important It provides context and explains Owhy the dentist dislikes the mayor It provides context and explains Owhy the mayor dislikes the dentist O It is a flashback
The Small Business Development Centers operate at O State Universities O Colleges Both state Universities and colleges Higher Secondary schools
Biology
Biotechnology & its Applications
The Small Business Development Centers operate at O State Universities O Colleges Both state Universities and colleges Higher Secondary schools
A major contributing factor to the failure of the savings and loan in industry the 1980s was the establishment Federal Deposit Insurance Corporation by Congress to insure individual bank deposits of the the Depository Institutions Deregulation and Monetary O Control Act passed by Congress which allowed Saving Loans to make risky loans the creation of the Comptroller of the Currency to grant charters for ional har ONO
Biology
Biotechnology & its Applications
A major contributing factor to the failure of the savings and loan in industry the 1980s was the establishment Federal Deposit Insurance Corporation by Congress to insure individual bank deposits of the the Depository Institutions Deregulation and Monetary O Control Act passed by Congress which allowed Saving Loans to make risky loans the creation of the Comptroller of the Currency to grant charters for ional har ONO
A privately owned cable TV company granted exclusive rights rights to a particular area would be considered a O natural monopoly government monopoly O technological monopoly geographic monopoly
Biology
Biotechnology & its Applications
A privately owned cable TV company granted exclusive rights rights to a particular area would be considered a O natural monopoly government monopoly O technological monopoly geographic monopoly
Draw the skeletal line structure of 3 5 diethyl 1 propylcyclohexanol
Biology
Biotechnology & its Applications
Draw the skeletal line structure of 3 5 diethyl 1 propylcyclohexanol
Which of the following is closest to a micrometer in size The width of a strand of DNA The length of a plant cell The length of a chicken egg A typical prokaryotic cell
Biology
Biotechnology & its Applications
Which of the following is closest to a micrometer in size The width of a strand of DNA The length of a plant cell The length of a chicken egg A typical prokaryotic cell
Living systems are not magical entities Cells obey the laws of physics and chemistry Therefore what central principle of chemistry explains why the enzymes that replicate DNA called DNA polymerases must make mistakes during replication Your answer should be no more than 1 3 sentences
Biology
Biotechnology & its Applications
Living systems are not magical entities Cells obey the laws of physics and chemistry Therefore what central principle of chemistry explains why the enzymes that replicate DNA called DNA polymerases must make mistakes during replication Your answer should be no more than 1 3 sentences
Question 6 Points 3 What is another name for the essay Civil Disobedience O Self Reliance O American Scholar O Resistance to Civil Government O Fanshawe
Biology
Biotechnology & its Applications
Question 6 Points 3 What is another name for the essay Civil Disobedience O Self Reliance O American Scholar O Resistance to Civil Government O Fanshawe
1 Some students might notice a difference in density turbidity of growth in nutrient broth tubes inoculated from nutrient broth versus inoculated from a nutrient agar slant or plate Suggest some reasons why a difference may occur
Biology
Biotechnology & its Applications
1 Some students might notice a difference in density turbidity of growth in nutrient broth tubes inoculated from nutrient broth versus inoculated from a nutrient agar slant or plate Suggest some reasons why a difference may occur
Neptune is the eighth and farthest planet from the Sun in the Solar System It is the fourt largest planet by diameter and the third largest by mass Neptune is 17 times the mass Earth and is somewhat more massive than its near twin Uranus which is 15 times the mas of Earth but not as dense On average Neptune orbits the Sun at a distance of 30 1 AL approximately 30 times the Earth Sun distance Named for the Roman god of the sea its astronomical symbol is a stylized version of the god Neptune s trident Neptune was the first planet found by mathematical prediction rather than by empirical observation Unexpected changes in the orbit of Uranus led Alexis Bouvard to deduce that its orbit was subject to gravitational perturbation by an unknown planet Neptune was subsequently observed on September 23 1846 by Johann Galle within a degree of the position predicted by Urbain Le Verrier and its largest moon Triton was discovered shortly thereafter though none of the planet s remaining 12 moons were located telescopically until the 20th century Neptune has been visited by only one spacecraft Voyager 2 which flew by the planet on August 25 1989 O Uranus Neptune Earth Sun distance
Biology
Biotechnology & its Applications
Neptune is the eighth and farthest planet from the Sun in the Solar System It is the fourt largest planet by diameter and the third largest by mass Neptune is 17 times the mass Earth and is somewhat more massive than its near twin Uranus which is 15 times the mas of Earth but not as dense On average Neptune orbits the Sun at a distance of 30 1 AL approximately 30 times the Earth Sun distance Named for the Roman god of the sea its astronomical symbol is a stylized version of the god Neptune s trident Neptune was the first planet found by mathematical prediction rather than by empirical observation Unexpected changes in the orbit of Uranus led Alexis Bouvard to deduce that its orbit was subject to gravitational perturbation by an unknown planet Neptune was subsequently observed on September 23 1846 by Johann Galle within a degree of the position predicted by Urbain Le Verrier and its largest moon Triton was discovered shortly thereafter though none of the planet s remaining 12 moons were located telescopically until the 20th century Neptune has been visited by only one spacecraft Voyager 2 which flew by the planet on August 25 1989 O Uranus Neptune Earth Sun distance
A an does not use the word like or the word as O metaphor Osimile O analogy O comparison Complete lister Complete
Biology
Biotechnology & its Applications
A an does not use the word like or the word as O metaphor Osimile O analogy O comparison Complete lister Complete